PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS58300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 164aa    MW: 18802.1 Da    PI: 9.6283
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS58300.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.37.5e-1364107447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      WT++E+ ++ ++ + +G+g+Wk+I++ +  ++t  q+ s+ qky
       EPS58300.1  64 WTEDEHRKFMQGLEAYGKGNWKKISNNFVITKTHTQVASHAQKY 107
                      *****************************889***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.53146IPR017877Myb-like domain
PROSITE profilePS5129415.11455112IPR017930Myb domain
SuperFamilySSF466891.31E-1657112IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-1058108IPR009057Homeodomain-like
TIGRFAMsTIGR015577.0E-1859110IPR006447Myb domain, plants
SMARTSM007171.4E-660110IPR001005SANT/Myb domain
PfamPF002491.1E-1163107IPR001005SANT/Myb domain
CDDcd001676.40E-864108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MEEVDRKFGI VSKIFDENSP DRWEKISEVL NGMSPEFLKS KYESYLREFG TLTGEVTKKK  60
VSHWTEDEHR KFMQGLEAYG KGNWKKISNN FVITKTHTQV ASHAQKYFLH HQGDDNNNSQ  120
SEKKRKRPSI HDTTIHDVVT PRPIAANVSS TSSTTAPPPP LFIV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLS8BUP21e-120S8BUP2_9LAMI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-27MYB family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]